Pay in 4 interest-free payments of $5.03 Learn more
Ships within 48 hours · Estimated delivery Aug 12 - Aug 17
Also the height can be modified according to specific requirement.
About this product Product Identifiers BrandApplied Nutrition GTIN0634158743436 UPC0634158743436 eBay Product ID (ePID)15007920752 Product Key Features When to TakeAfter Meal FormulationLiquid Type of DietVegan Number of Pills1 FlavourOrange IngredientsGreen Tea, Water, Malic Acid, L-Carnitine Active IngredientsGreen Tea, L-Carnitine Main PurposeBodybuilding, Gym & Training, Metabolism Support Dimensions Volume495 ml Item Weight0.57 1 users rated this 5 out of 5 stars 0 users rated this 4 out of 5 stars 0 users rated this 3 out of 5 stars 0 users rated this 2 out of 5 stars 0 users rated this 1 out of 5 stars Most relevant reviews Good and fast parcel Thanks Verified purchase: YesCondition: New Best-selling in Protein Shakes & Bodybuilding Save on Protein Shakes & Bodybuilding Trending price is based on prices over last 90 days.
The Tesamorelin component is a 44-residue-derived GHRH analog sequence supplied here as the 29-residue C-terminally amidated fragment YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, with molecular formula C221H366N72O67S and a monoisotopic-consistent average molecular weight of approximately 5196 g/mol
After 14 days of culture, pellets were harvested for histological analysis
US$ 28.02
US$ 20.85
US$ 24.97
US$ 24.79
